PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27469 Da    PI: 8.4748
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58679240PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97e-18103157256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++tk q   Lee+F+ +  ++ +++++LA+ l+L  rqV vWFqNrRa+ k
  Lsa006877 103 RKKLRLTKAQSGLLEEAFKLHTSLNPQQKQKLARDLKLRPRQVEVWFQNRRARTK 157
                678899***********************************************98 PP

2HD-ZIP_I/II115.14.3e-37103192190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rl+k q+ lLEe F+ ++ L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL++ev+eL+++
    Lsa006877 103 RKKLRLTKAQSGLLEEAFKLHTSLNPQQKQKLARDLKLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCKRLTDENQRLRQEVHELKTQ 192
                  69*************************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1687160IPR009057Homeodomain-like
PROSITE profilePS5007116.55299159IPR001356Homeobox domain
SuperFamilySSF466894.71E-17101168IPR009057Homeodomain-like
SMARTSM003893.6E-14101163IPR001356Homeobox domain
CDDcd000861.00E-13103160No hitNo description
PfamPF000462.3E-15103157IPR001356Homeobox domain
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
SMARTSM003405.1E-21159202IPR003106Leucine zipper, homeobox-associated
PfamPF021833.5E-9159192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGFHGFAKAE LVLELGLNSS SMAENTTKPT KKPYLSFDHP LEPSLSLALS GDSYGGAGGG  60
SSFSNASVKR ERDVASEESE RVGAINTCGE DGEEDEDGSV NGRKKLRLTK AQSGLLEEAF  120
KLHTSLNPQQ KQKLARDLKL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKK CCKRLTDENQ  180
RLRQEVHELK TQKLLQPIYM QMPAATLTMC PSCEQNGDTN PASKNIPFTM APKRDFFSPY  240
SSSSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151159RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002271511.23e-88PREDICTED: homeobox-leucine zipper protein HAT22 isoform X2
RefseqXP_011073661.18e-89PREDICTED: homeobox-leucine zipper protein HAT22-like isoform X2
SwissprotP466041e-75HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLQ399271e-116Q39927_HELAN; Homeodomain protein
STRINGVIT_00s0732g00010.t019e-88(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-64HD-ZIP family protein